PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000049.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 396aa    MW: 44072.9 Da    PI: 7.6365
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000049.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.46.8e-54211481128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL+ kv + +++   +i+evd++++ePw+Lp  +k +e+ewyfFs rd+ky+tg r+nrat +gyWkat
  Itr_sc000049.1_g00003.1  21 LPPGFRFHPTDEELITFYLASKVFHGTFSG-IHITEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPTGLRTNRATGAGYWKAT 105
                              79*************************999.78***************8888899******************************* PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+ev+s+ +g+l g+kktLvfy+grap+gekt+Wvmheyrl
  Itr_sc000049.1_g00003.1 106 GKDREVYSAsSGALLGMKKTLVFYRGRAPRGEKTKWVMHEYRL 148
                              *******9978889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-6318170IPR003441NAC domain
PROSITE profilePS5100559.65721170IPR003441NAC domain
PfamPF023652.5E-2722148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MLGIEEILCE LNRDEDNEQG LPPGFRFHPT DEELITFYLA SKVFHGTFSG IHITEVDLNR  60
CEPWELPDVA KMGEREWYFF SLRDRKYPTG LRTNRATGAG YWKATGKDRE VYSASSGALL  120
GMKKTLVFYR GRAPRGEKTK WVMHEYRLDG HFSCRHTCKE EWVICRIYHK IGEKRNAIMV  180
QAAGGGQSYP TLKTLTSSAN VALPPFPEMQ SQNPMQHHHH HKSIVFHHQE NDLKSINHHH  240
PLLPQTNLLG LPSINGVLSS SFSAITSNKT TPTTSKANML DCNNTILLPS SSSSSSILFK  300
SQTGSSKSNA IATTAANCKI SPCHLSETEK YQNNPLFYGM GMGASPVTGF GFETMMPSAA  360
ATFDGMSTSP EGFTRTCSQM VDPPIQLTAD SWPMDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-52131737171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002300627.11e-137hypothetical protein POPTR_0002s00730g
SwissprotQ9S8511e-107NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLB9GPP51e-137B9GPP5_POPTR; Uncharacterized protein
STRINGPOPTR_0002s00730.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.11e-106NAC family protein